Streptomyces solicathayae: R2D22_23030 Help Entry R2D22_23030       CDS       T11073                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ssli  Streptomyces solicathayae Brite KEGG Orthology (KO) [BR:ssli00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ssli03032]     R2D22_23030    03036 Chromosome and associated proteins [BR:ssli03036]     R2D22_23030    03400 DNA repair and recombination proteins [BR:ssli03400]     R2D22_23030 DNA replication proteins [BR:ssli03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     R2D22_23030 Chromosome and associated proteins [BR:ssli03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     R2D22_23030 DNA repair and recombination proteins [BR:ssli03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       R2D22_23030 BRITE hierarchy Other DBs NCBI-ProteinID:  WOX24096 LinkDB All DBs Position 4974357..4974638 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAALAETVGEVVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIDIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgccctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgtgctggccgctctcgccgagaccgtcggcgaggtcgtcgccaagggcgac gagaaggtcaccatccccggctttctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgtaacccgcagaccggcgacccgatcgacatcccggccggctacagcgtgaaggtc tccgcgggctcgaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system