KEGG   Sediminispirochaeta smaragdinae: Spirs_1886
Entry
Spirs_1886        CDS       T01287                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
ssm  Sediminispirochaeta smaragdinae
Pathway
ssm00770  Pantothenate and CoA biosynthesis
ssm01100  Metabolic pathways
ssm01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ssm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Spirs_1886
Enzymes [BR:ssm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     Spirs_1886
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ADK81012
UniProt: E1R6J4
LinkDB
Position
2039424..2039903
AA seq 159 aa
MLKAMFPGTFDPPTNGHLNLITRAAAIFEKVYVVIAVNRGKSCFFSEQERFLMMQELLAP
YGNVEVVLWDRLVVEFAAAHDVKVMLRGVRALADFGYEFELAMTNKGLAPDLEIMFMPTD
PKYFVLRSSAIKEIADFGGDVSSMVPPLVVKALKERHQR
NT seq 480 nt   +upstreamnt  +downstreamnt
atgttgaaagcaatgtttccagggaccttcgatccccctacaaacggacatttgaacctc
atcaccagagcggcagcgatttttgaaaaggtctatgttgttatagcggtgaatagagga
aaaagctgttttttcagtgaacaggagcgttttttgatgatgcaggaactcctggctccc
tatggcaacgtcgaggtggtcctctgggatcggcttgttgttgaatttgcggccgcacac
gatgtaaaggtcatgctcagaggcgtaagagccctcgccgacttcggttatgaatttgaa
ctggccatgaccaacaaagggcttgccccggatcttgagatcatgtttatgcccaccgac
ccgaaatactttgtcctgcgatcatccgctatcaaggagattgccgatttcggtggtgat
gtttcatcgatggttcctcctttggtcgtaaaggctttaaaggagcgtcatcagcggtga

DBGET integrated database retrieval system