Shigella sonnei Ss046: SSON_0986 Help Entry SSON_0986         CDS       T00274                                  Symbol yccB Name (GenBank) Uncharacterized protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism ssn  Shigella sonnei Ss046 Pathway ssn00190   Oxidative phosphorylation ssn01100   Metabolic pathways ssn02020   Two-component system Module ssn_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ssn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SSON_0986 (yccB)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SSON_0986 (yccB) Enzymes [BR:ssn01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      SSON_0986 (yccB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  AAZ87720 ShiBASE_China:  SSO0986 UniProt:  Q3Z3E2 LinkDB All DBs Position 1060088..1060180 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system