Shigella sonnei Ss046: SSON_3541
Help
Entry
SSON_3541 CDS
T00274
Symbol
yhgG
Name
(GenBank) conserved hypothetical protein
KO
K07490
ferrous iron transport protein C
Organism
ssn
Shigella sonnei Ss046
Brite
KEGG Orthology (KO) [BR:
ssn00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ssn02000
]
SSON_3541 (yhgG)
Transporters [BR:
ssn02000
]
Other transporters
Others
SSON_3541 (yhgG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FeoC
TrmB
HTH_24
HTH_IclR
Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID:
AAZ90097
ShiBASE_China:
SSO3541
UniProt:
Q3YWL5
LinkDB
All DBs
Position
3705403..3705639
Genome browser
AA seq
78 aa
AA seq
DB search
MASLIQVRDLLALRGRMEATQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGS
CKSCPEGKACLREWWALR
NT seq
237 nt
NT seq
+upstream
nt +downstream
nt
atggcttcacttattcaggtacgtgatttgctggcgttacggggccgtatggaagcgacc
cagataagccagacattgaacactccgcagccaatgattaacgccatgctgcaacaactg
gaaagtatgggcaaagccgtgcggattcaggaagaacctgacggctgcctctctggcagt
tgtaaaagctgcccggaaggaaaagcctgtctgcgcgagtggtgggcgctgcgttaa
DBGET
integrated database retrieval system