KEGG   Shigella sonnei Ss046: SSON_3541
Entry
SSON_3541         CDS       T00274                                 
Symbol
yhgG
Name
(GenBank) conserved hypothetical protein
  KO
K07490  ferrous iron transport protein C
Organism
ssn  Shigella sonnei Ss046
Brite
KEGG Orthology (KO) [BR:ssn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssn02000]
    SSON_3541 (yhgG)
Transporters [BR:ssn02000]
 Other transporters
  Others
   SSON_3541 (yhgG)
SSDB
Motif
Pfam: FeoC TrmB HTH_24 HTH_IclR Fe_dep_repress
Other DBs
NCBI-ProteinID: AAZ90097
ShiBASE_China: SSO3541
UniProt: Q3YWL5
LinkDB
Position
3705403..3705639
AA seq 78 aa
MASLIQVRDLLALRGRMEATQISQTLNTPQPMINAMLQQLESMGKAVRIQEEPDGCLSGS
CKSCPEGKACLREWWALR
NT seq 237 nt   +upstreamnt  +downstreamnt
atggcttcacttattcaggtacgtgatttgctggcgttacggggccgtatggaagcgacc
cagataagccagacattgaacactccgcagccaatgattaacgccatgctgcaacaactg
gaaagtatgggcaaagccgtgcggattcaggaagaacctgacggctgcctctctggcagt
tgtaaaagctgcccggaaggaaaagcctgtctgcgcgagtggtgggcgctgcgttaa

DBGET integrated database retrieval system