Shigella sonnei Ss046: SSON_4011 Help Entry SSON_4011         CDS       T00274                                  Name (GenBank) conserved hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism ssn  Shigella sonnei Ss046 Pathway ssn03060   Protein export ssn03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ssn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SSON_4011  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SSON_4011  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ssn02044]     SSON_4011 Secretion system [BR:ssn02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SSON_4011 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF4834 DUF2207_C Motif Other DBs NCBI-ProteinID:  AAZ90533 ShiBASE_China:  SSO4011 UniProt:  Q3YVC9 LinkDB All DBs Position 4239347..4239658 Genome browser AA seq 103 aa AA seqDB search MRPCLIIIYHRGTCMGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDD EPKQDKTSQDADFTAKTIADKQADTNQEQAKTEDAKRHDKEQV NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcggccttgtttaatcatcatctaccacagaggaacatgtatgggtggtatcagtatt tggcagttattgattattgccgtcatcgttgtactgctttttggcaccaaaaagctcggc tccatcggttccgatcttggtgcgtcgatcaaaggctttaaaaaagcaatgagcgatgat gaaccaaagcaggataaaaccagtcaggatgctgattttactgcgaaaactatcgccgat aagcaggcggatacgaatcaggaacaggctaaaacagaagacgcgaagcgccacgataaa gagcaggtgtaa

DBGET integrated database retrieval system