Shigella sonnei Ss046: SSON_4154 Help Entry SSON_4154         CDS       T00274                                  Symbol secE Name (GenBank) preprotein translocase   KO K03073   preprotein translocase subunit SecE Organism ssn  Shigella sonnei Ss046 Pathway ssn02024   Quorum sensing ssn03060   Protein export ssn03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ssn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SSON_4154 (secE)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SSON_4154 (secE)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SSON_4154 (secE)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ssn02044]     SSON_4154 (secE) Secretion system [BR:ssn02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    SSON_4154 (secE) SSDB OrthologParalogGFIT Motif Pfam:  SecE BacA Motif Other DBs NCBI-ProteinID:  AAZ90659 ShiBASE_China:  SSO4154 UniProt:  Q3YV03 LinkDB All DBs Position 4396489..4396872 Genome browser AA seq 127 aa AA seqDB search MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgaataccgaagctcaaggaagcgggcgcggcctggaagcgatgaagtgggtc gttgtggtggcattgctcctggtggcgattgtcggcaactacctttatcgcgacattatg ctgccgctgcgtgcgctggccgtagtaattctgattgctgcagcgggtggtgtcgcgctg ttaacgacaaaaggtaaagctaccgttgcttttgcccgtgaagcgcgtaccgaagtccgt aaggtcatttggccgactcgccaggaaacattgcacaccacgctgattgtggctgcggtt accgcagtaatgtcactgatcctgtggggactggatggtattctggttcgcctggtatcc tttatcactggcctgaggttctga

DBGET integrated database retrieval system