Shigella sonnei Ss046: SSON_P118 Help Entry SSON_P118         CDS       T00274                                  Name (GenBank) conserved hypothetical protein   KO K21976   probable RcsB/C two-component-system connector, global regulator of biofilm formation and acid-resistance Organism ssn  Shigella sonnei Ss046 Brite KEGG Orthology (KO) [BR:ssn00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99995 Signaling proteins     SSON_P118 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YmgB Motif Other DBs NCBI-ProteinID:  AAZ91138 ShiBASE_China:  SSOP118 UniProt:  Q3YTM4 LinkDB All DBs Position pSS_046:108668..108901 Genome browser AA seq 77 aa AA seqDB search MGVNFCNKIGIDQSEFEIESSIINSIANEVLNPISFLSNKDIINVLLRKISSECDLVRKD IYRCALELVVEKTPDDL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgggagttaatttctgtaataaaataggtattgatcagtctgaatttgaaatagaatct tccatcattaactccattgctaatgaggtattgaacccaatatctttccttagcaataag gatataataaatgttttactcagaaagatttcatctgaatgtgacctggttagaaaagac atttatcgttgtgctctggagttggtcgttgaaaaaacacctgatgatttataa

DBGET integrated database retrieval system