Saccharolobus solfataricus SULA: SULA_03265 Help Entry SULA_03265        CDS       T03910                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ssoa  Saccharolobus solfataricus SULA Pathway ssoa03010   Ribosome Brite KEGG Orthology (KO) [BR:ssoa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SULA_03265   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SULA_03265  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ssoa03011]     SULA_03265    04121 Ubiquitin system [BR:ssoa04121]     SULA_03265   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssoa04147]     SULA_03265 Ribosome [BR:ssoa03011]  Ribosomal proteins   Eukaryotes    Small subunit     SULA_03265   Archaea     SULA_03265 Ubiquitin system [BR:ssoa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SULA_03265 Exosome [BR:ssoa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SULA_03265   Exosomal proteins of colorectal cancer cells    SULA_03265 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB Zn_ribbon_SprT YPEH2ZP Zn_ribbon_PriA Zn_ribbon_Nudix Zn_ribbon_RPB9 UPF0179 Lar_restr_allev Zn_Ribbon_1 YhfH DUF7838 FlhC DUF5795 Zn_ribbon_3 ComFA_N DUF1451 Zn_ribbon_13 DUF6758 Zn_ribbon_ACC Motif Other DBs NCBI-ProteinID:  AYP18590 LinkDB All DBs Position complement(1365443..1365634) Genome browser AA seq 63 aa AA seqDB search MAKEQKVKAIVRTYYVIEGNKVKLKNKKCPRCGSIMAHHLKPNERWSCGKCGYTEFIGAS KKR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt gtggccaaggagcaaaaggttaaagcaatagtaaggacttattacgtgatcgaagggaat aaggtaaagctgaaaaataagaaatgccctagatgtggaagtataatggctcatcaccta aaaccaaatgaaagatggtcttgtggaaagtgtggttacactgagtttataggcgcttct aagaaaagataa

DBGET integrated database retrieval system