Solea solea (common sole): 131457950 Help Entry 131457950         CDS       T10853                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism ssoe  Solea solea (common sole) Pathway ssoe04145   Phagocytosis ssoe04517   IgSF CAM signaling ssoe04814   Motor proteins ssoe05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssoe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     131457950 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     131457950 (dynll2b)   09142 Cell motility    04814 Motor proteins     131457950 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131457950 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ssoe03037]     131457950 (dynll2b)    04812 Cytoskeleton proteins [BR:ssoe04812]     131457950 (dynll2b) Cilium and associated proteins [BR:ssoe03037]  Motile cilia and associated proteins   Dynein arm    131457950 (dynll2b) Cytoskeleton proteins [BR:ssoe04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      131457950 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  131457950 NCBI-ProteinID:  XP_058482482 LinkDB All DBs Position 4:24764084..24766688 Genome browser AA seq 89 aa AA seqDB search MSDKKAVIKNADMSDEMQQDSVDCAMQAVEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaagaaggccgtgattaaaaatgcagacatgtctgatgagatgcagcaggat tcagtggactgtgccatgcaggcggtggagaagtacaacatagagaaggacattgctgct tatgtcaaaaaggagtttgataagaagtacaatcccacatggcactgcattgttgggagg aacttcggcagctatgtgacacacgagacaaagcatttcatctacttctacctgggtcaa gtggccattcttctcttcaagtcgggctga

DBGET integrated database retrieval system