Solea solea (common sole): 131467122 Help Entry 131467122         CDS       T10853                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism ssoe  Solea solea (common sole) Pathway ssoe03030   DNA replication ssoe03410   Base excision repair ssoe03420   Nucleotide excision repair ssoe03430   Mismatch repair ssoe03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ssoe00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     131467122 (pold4)    03410 Base excision repair     131467122 (pold4)    03420 Nucleotide excision repair     131467122 (pold4)    03430 Mismatch repair     131467122 (pold4)    03440 Homologous recombination     131467122 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ssoe03032]     131467122 (pold4)    03400 DNA repair and recombination proteins [BR:ssoe03400]     131467122 (pold4) DNA replication proteins [BR:ssoe03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     131467122 (pold4) DNA repair and recombination proteins [BR:ssoe03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       131467122 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      131467122 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  131467122 NCBI-ProteinID:  XP_058496836 LinkDB All DBs Position 10:complement(27987332..27991836) Genome browser AA seq 113 aa AA seqDB search MTTKRGLITDSFKVVKKGRRGGKRQKQRATPPPSPPQQESDSEAVREDELHKLRQFDLDW RFGPCTGISRLQRWERAKLHGLDPPEEIRELLLLPQTHTDPEYTLSLWREYPL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaagcgtggactgataacggattcgttcaaggtggtgaagaaaggaaggaga ggtggcaaacggcagaagcaacgggcgacgcctcctccttctcctcctcagcaagagtct gacagtgaagcggtcagagaggacgagctgcacaagctcagacagtttgatctggactgg aggttcgggccgtgcacagggatcagcaggctgcagaggtgggagagagcaaagcttcat ggtctggatccacctgaggagatcagagagctgctgctgctgccgcagacgcacactgac cccgagtacacgctgagcctgtggagagagtatccactgtga

DBGET integrated database retrieval system