Solea solea (common sole): 131470331 Help Entry 131470331         CDS       T10853                                  Symbol calml4b Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism ssoe  Solea solea (common sole) Pathway ssoe04020   Calcium signaling pathway ssoe04070   Phosphatidylinositol signaling system ssoe04114   Oocyte meiosis ssoe04218   Cellular senescence ssoe04261   Adrenergic signaling in cardiomyocytes ssoe04270   Vascular smooth muscle contraction ssoe04371   Apelin signaling pathway ssoe04625   C-type lectin receptor signaling pathway ssoe04744   Phototransduction ssoe04910   Insulin signaling pathway ssoe04912   GnRH signaling pathway ssoe04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ssoe00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     131470331 (calml4b)    04020 Calcium signaling pathway     131470331 (calml4b)    04070 Phosphatidylinositol signaling system     131470331 (calml4b)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     131470331 (calml4b)    04218 Cellular senescence     131470331 (calml4b)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131470331 (calml4b)   09152 Endocrine system    04910 Insulin signaling pathway     131470331 (calml4b)    04912 GnRH signaling pathway     131470331 (calml4b)    04916 Melanogenesis     131470331 (calml4b)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     131470331 (calml4b)    04270 Vascular smooth muscle contraction     131470331 (calml4b)   09157 Sensory system    04744 Phototransduction     131470331 (calml4b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ssoe01009]     131470331 (calml4b)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssoe04131]     131470331 (calml4b)    03036 Chromosome and associated proteins [BR:ssoe03036]     131470331 (calml4b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssoe04147]     131470331 (calml4b) Protein phosphatases and associated proteins [BR:ssoe01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      131470331 (calml4b) Membrane trafficking [BR:ssoe04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     131470331 (calml4b) Chromosome and associated proteins [BR:ssoe03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      131470331 (calml4b) Exosome [BR:ssoe04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    131470331 (calml4b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 AIF-1 EF-hand_5 DUF5580_M EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  131470331 NCBI-ProteinID:  XP_058502062 LinkDB All DBs Position 12:28205891..28209102 Genome browser AA seq 153 aa AA seqDB search MAKFLTQDQINEFKECFSLYDRQRKGKIGAQELITVMRCLGSSPTHSEVQRHLLSHSIDR SGELDFSTFLTIMHQQLQQEAPEEEILEALRMADKEQKGFVRASELRATLTGHGEKLTHK EVDELLKEAGVGADGRVHCEQFAKAVTRSSVKR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagttcctgacccaggatcagattaatgagttcaaagagtgtttctctctctac gaccgacaacgcaaagggaagatcggagcccaggagctgatcactgtgatgcgctgcctc ggctcaagccccacccactctgaggtccagcgccacctgctgagccacagcatagatcgc agcggagagctggacttttccaccttcctgactatcatgcaccagcagctccagcaggag gcgccagaggaggagatcctggaggccctgaggatggccgacaaggagcagaaaggcttc gtccgagcgtccgagctgcgagcgacgctcaccggccacggagagaagctgacccacaag gaagtggacgagctgctgaaggaggcgggcgtcggggcggacggccgcgtccactgtgag cagtttgctaaagcagtgacgcgttcgtctgtgaagcgctga

DBGET integrated database retrieval system