Solea solea (common sole): 131472033 Help Entry 131472033         CDS       T10853                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism ssoe  Solea solea (common sole) Pathway ssoe03082   ATP-dependent chromatin remodeling ssoe04217   Necroptosis Brite KEGG Orthology (KO) [BR:ssoe00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     131472033  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     131472033  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssoe03036]     131472033   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssoe04147]     131472033 Chromosome and associated proteins [BR:ssoe03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131472033 Exosome [BR:ssoe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131472033 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  131472033 NCBI-ProteinID:  XP_058504885 LinkDB All DBs Position 1:18073997..18074961 Genome browser AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKSRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKPAKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgtcaggaagaggcaaaaccggcggaaaagcccgcgccaaggcaaagactcgctcctct cgtgctggactccagttccccgtcggtcgtgttcacaggctgctgcgcaaaggcaactac gctcaccgtgtgggtgccggcgcccccgtctatctggccgctgtgctcgagtacctgacc gctgagatcctggagctggctggaaacgccgcccgcgacaacaagaagagccgtatcatc ccccgccacctgcagctggccgtccgcaacgacgaggagctcaacaaactcctgggcgga gtgaccatcgctcagggcggcgtgctgcccaacatccaggctgttcttctgcccaagaag accgagaagcccgccaagtccaagtaa

DBGET integrated database retrieval system