Solea solea (common sole): 131472196 Help Entry 131472196         CDS       T10853                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism ssoe  Solea solea (common sole) Pathway ssoe04020   Calcium signaling pathway ssoe04070   Phosphatidylinositol signaling system ssoe04114   Oocyte meiosis ssoe04218   Cellular senescence ssoe04261   Adrenergic signaling in cardiomyocytes ssoe04270   Vascular smooth muscle contraction ssoe04371   Apelin signaling pathway ssoe04625   C-type lectin receptor signaling pathway ssoe04744   Phototransduction ssoe04910   Insulin signaling pathway ssoe04912   GnRH signaling pathway ssoe04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ssoe00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     131472196    04020 Calcium signaling pathway     131472196    04070 Phosphatidylinositol signaling system     131472196  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     131472196    04218 Cellular senescence     131472196  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131472196   09152 Endocrine system    04910 Insulin signaling pathway     131472196    04912 GnRH signaling pathway     131472196    04916 Melanogenesis     131472196   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     131472196    04270 Vascular smooth muscle contraction     131472196   09157 Sensory system    04744 Phototransduction     131472196  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ssoe01009]     131472196   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssoe04131]     131472196    03036 Chromosome and associated proteins [BR:ssoe03036]     131472196   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssoe04147]     131472196 Protein phosphatases and associated proteins [BR:ssoe01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      131472196 Membrane trafficking [BR:ssoe04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     131472196 Chromosome and associated proteins [BR:ssoe03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      131472196 Exosome [BR:ssoe04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    131472196 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg Dockerin_1 EF-hand_EFHB_C EF-hand_11 UPF0154 EFhand_Ca_insen EF-hand_SWAP70_N DUF5580_M SAPC2_N EF-hand_STIM1 DUF5580 Motif Other DBs NCBI-GeneID:  131472196 NCBI-ProteinID:  XP_058505088 LinkDB All DBs Position 14:complement(2744610..2745520) Genome browser AA seq 147 aa AA seqDB search MADQLTKEQVEEFREAFSLFDKDGTINTKELGTVLRTLGINPTEEALQDMINEVDADGDG TMELAEFLALMTRKMKDTDTEEEIKEAFRVFDMDGSGFISASELRHVMANLGEKLTDEEV SEMMREADTDGDGKVNYQEFVKMMATK NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctgacaaaggagcaggttgaggagttcagggaggcgttctcactcttt gacaaagacggcaccatcaacaccaaagagctgggcacagtcctgcgcactctgggcata aaccccaccgaagaagctctgcaggacatgatcaacgaagtggacgccgatggggacgga acgatggagttggcggagttcctggccctgatgaccaggaagatgaaggacacggacacc gaggaggagatcaaagaggcgttccgcgtcttcgacatggacggcagcggattcatcagc gcgtccgagctgcgtcacgtgatggcgaacctcggagagaagctgacggacgaggaagtg agcgagatgatgagagaagcagatacggacggagacggaaaggtcaactatcaagagttt gtgaaaatgatggcgacgaagtga

DBGET integrated database retrieval system