Solea solea (common sole): 131475643 Help Entry 131475643         CDS       T10853                                  Symbol gng14 Name (RefSeq) GGL domain-containing protein   KO K04347   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 Organism ssoe  Solea solea (common sole) Pathway ssoe04010   MAPK signaling pathway ssoe04081   Hormone signaling ssoe04082   Neuroactive ligand signaling ssoe04371   Apelin signaling pathway ssoe04810   Regulation of actin cytoskeleton Brite Exosome [BR:ssoe04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    131475643 (gng14)   Exosomal proteins of colorectal cancer cells    131475643 (gng14) GTP-binding proteins [BR:ssoe04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     131475643 (gng14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  G-gamma Motif Other DBs NCBI-GeneID:  131475643 NCBI-ProteinID:  XP_058509876 LinkDB All DBs Position 16:complement(17655602..17656212) Genome browser AA seq 72 aa AA seqDB search MSEKTCTSNSVVQTHKLIDQLRLEASMERIKISLTAADLIQYCKDHRHSDPLLTGIASSS NPFKDKKTCVLL NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcggaaaagacgtgcaccagcaacagtgttgttcagacacataaactgatcgatcaa ctgcggctagaggcaagcatggagagaatcaagatatccctgacagcagcagacttgatc cagtactgtaaggatcacagacacagtgaccctctgctcactggcatcgccagctcatcc aatcctttcaaagataagaagacctgtgtgctgctttga

DBGET integrated database retrieval system