Streptomyces solisilvae: I1A49_07820 Help Entry I1A49_07820       CDS       T07406                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism ssoi  Streptomyces solisilvae Pathway ssoi01051   Biosynthesis of ansamycins ssoi01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:ssoi00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     I1A49_07820    01051 Biosynthesis of ansamycins     I1A49_07820  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssoi01008]     I1A49_07820 Polyketide biosynthesis proteins [BR:ssoi01008]  Polyketide tailoring proteins   Others    I1A49_07820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 SIDD_N Motif Other DBs NCBI-ProteinID:  QPI54853 LinkDB All DBs Position complement(2079839..2080114) Genome browser AA seq 91 aa AA seqDB search MTISSEQGSHTAETVAQEVQQFLEQRTKQTWDPDTDLFSTGAVSSMFAMELVVHLESSFD VVISGPDLALDNFRTVNAMTAMVLRLRGVKP NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgaccatctcatccgagcagggcagccacaccgccgagacggtggcgcaggaggtgcag cagttcctcgaacagcgcaccaagcagacctgggacccggacaccgacctgttcagcacc ggcgccgtgtcctcgatgttcgccatggaactggtcgtgcacctggagtcgtccttcgac gtggtgatcagcggccccgatctggcgctggacaacttccgtacggtgaacgcgatgacc gcgatggtcctgcggctgcgcggggtcaagccgtga

DBGET integrated database retrieval system