Streptomyces solisilvae: I1A49_09375 Help Entry I1A49_09375       CDS       T07406                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism ssoi  Streptomyces solisilvae Pathway ssoi01051   Biosynthesis of ansamycins ssoi01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:ssoi00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     I1A49_09375    01051 Biosynthesis of ansamycins     I1A49_09375  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssoi01008]     I1A49_09375 Polyketide biosynthesis proteins [BR:ssoi01008]  Polyketide tailoring proteins   Others    I1A49_09375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPI55119 LinkDB All DBs Position 2437789..2438079 Genome browser AA seq 96 aa AA seqDB search MTTSSDQPVPDSSAVQTEMLGYLTKRTGTTWATDADVFGSGGLSSLFAMELVVHLEKSYG IAIRGADLRVENFRTVRRMAALVERLRQPTPGGSGA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaccacgtcatccgaccagccggtgccggattccagcgccgtccagacggaaatgctg gggtacctgacgaagcgtacggggacgacctgggcgaccgacgcggatgtcttcggctcc ggtgggctgtcctcgctcttcgccatggagctggtggtgcatctggagaagtcgtacggc atcgccatccgcggcgccgacctgcgggtggagaacttccgcaccgtgcggcggatggcc gcgctggtcgaacggctccggcagcccacccccggcggctccggcgcgtga

DBGET integrated database retrieval system