KEGG   Streptomyces solisilvae: I1A49_10185
Entry
I1A49_10185       CDS       T07406                                 

Name
(GenBank) cobalamin B12-binding domain-containing protein
  KO
K20907  2-hydroxyisobutanoyl-CoA mutase small subunit [EC:5.4.99.64]
Organism
ssoi  Streptomyces solisilvae
Brite
KEGG Orthology (KO) [BR:ssoi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    I1A49_10185
Enzymes [BR:ssoi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.64  2-hydroxyisobutanoyl-CoA mutase
     I1A49_10185
SSDB
Motif
Pfam: B12-binding
Other DBs
NCBI-ProteinID: QPI55247
UniProt: A0A7S9UU68
LinkDB
Position
complement(2641280..2641702)
AA seq 140 aa
MTAVQEETVAEPIRVMLAKIGLDGHDRGVKVVARTLRDAGMEVIYTGLHRRPEQVVEAAV
QEDVDILGISLLSGAHMPIFTRLFDLLAQLDEPYRFAIVAGGVMPDEDETELKQMGVGAV
LGQDSTPESIVAEIRSLAGR
NT seq 423 nt   +upstreamnt  +downstreamnt
atgacggcagtgcaagaagagacggttgccgagccgatccgggtgatgctcgcgaagatc
ggtctggacggccatgaccggggcgtgaaggtggtcgcgcgcacattgcgcgacgccggc
atggaggtcatctacaccggcctgcaccgcagaccggagcaggtcgtcgaggcggcggtg
caggaggacgtggacatcctcggcatcagcctcctgtccggggcccatatgcccatcttc
acgcggctcttcgacttgctggcccagctcgacgagccgtaccggttcgccatcgtggcc
ggcggtgtgatgccggacgaggacgagacggaactgaagcagatgggggtgggcgcggtg
ctcggccaggactccactcctgagtcgatcgtcgccgagatccgctccctggccgggagg
tga

DBGET integrated database retrieval system