Streptomyces solisilvae: I1A49_14995 Help Entry I1A49_14995       CDS       T07406                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssoi  Streptomyces solisilvae Pathway ssoi00998   Biosynthesis of various antibiotics ssoi01100   Metabolic pathways ssoi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssoi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I1A49_14995    00074 Mycolic acid biosynthesis     I1A49_14995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I1A49_14995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QPI56061 LinkDB All DBs Position 3786257..3786505 Genome browser AA seq 82 aa AA seqDB search MAATQEEILEGLAEIVNEIAGIPTEDVLLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDAVDYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcctcgagggtctcgccgagatcgtcaacgagatcgcc ggtatcccgaccgaggacgtcctgctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtggtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagaccgtcggcgacgccgtcgactacatcctcaagcac cagggctga

DBGET integrated database retrieval system