Streptomyces solisilvae: I1A49_19035 Help Entry I1A49_19035       CDS       T07406                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ssoi  Streptomyces solisilvae Brite KEGG Orthology (KO) [BR:ssoi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ssoi03032]     I1A49_19035    03036 Chromosome and associated proteins [BR:ssoi03036]     I1A49_19035    03400 DNA repair and recombination proteins [BR:ssoi03400]     I1A49_19035 DNA replication proteins [BR:ssoi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I1A49_19035 Chromosome and associated proteins [BR:ssoi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I1A49_19035 DNA repair and recombination proteins [BR:ssoi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I1A49_19035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG A_thal_3526 Motif Other DBs NCBI-ProteinID:  QPI56738 LinkDB All DBs Position complement(4776947..4777228) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALSERAEVTRKDADAVLAALAEVTGEVVAKGDEKVTIPGFLTFERTHRAART ARNPQTGEPIEIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgctctgtccgagcgcgccgaggtgacccgaaaggac gccgacgccgtgctggccgccctcgccgaggtgactggtgaggtcgtcgctaagggcgac gagaaggtcaccatccccggcttcctgacctttgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggtgagccgatcgagatcccggccggctacagcgtgaaggtc tccgcgggctccaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system