Streptomyces solisilvae: I1A49_30235 Help Entry I1A49_30235       CDS       T07406                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ssoi  Streptomyces solisilvae Pathway ssoi00190   Oxidative phosphorylation ssoi01100   Metabolic pathways Module ssoi_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ssoi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     I1A49_30235 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ssoi00194]     I1A49_30235 (atpE) Photosynthesis proteins [BR:ssoi00194]  Photosystem and electron transport system   F-type ATPase [OT]    I1A49_30235 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QPI58612 LinkDB All DBs Position 7331422..7331664 Genome browser AA seq 80 aa AA seqDB search MSALQTLAADGITGNLGSIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRANQIMG FAFCEALALIGIVMGFLFRS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccgctctccagaccctcgccgccgacggcatcaccggcaacctcggttcgatcggt tacggtctcgccgccatcggccccggcgtcggcgtcggcatcatcttcggtaacggcacc caggccctggcccgtcagcccgaggccgccggcctgatccgcgccaaccagatcatgggc ttcgctttctgtgaggcgctcgcgctgatcggtatcgtcatgggcttccttttcaggtcc tga

DBGET integrated database retrieval system