Saccharolobus solfataricus SARC-B: SULB_1797 Help Entry SULB_1797         CDS       T03911                                  Name (GenBank) ribonuclease P   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism ssol  Saccharolobus solfataricus SARC-B Pathway ssol03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:ssol00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     SULB_1797  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:ssol03009]     SULB_1797    03016 Transfer RNA biogenesis [BR:ssol03016]     SULB_1797    03029 Mitochondrial biogenesis [BR:ssol03029]     SULB_1797 Enzymes [BR:ssol01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      SULB_1797 Ribosome biogenesis [BR:ssol03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      SULB_1797 Transfer RNA biogenesis [BR:ssol03016]  Eukaryotic type   5'processing factors    Ribonucrease P     SULB_1797 Mitochondrial biogenesis [BR:ssol03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     SULB_1797 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 NAD_kinase_C LpxI_N Motif Other DBs NCBI-ProteinID:  AKA74038 UniProt:  A0A0E3MDT2 LinkDB All DBs Position complement(1638205..1638444) Genome browser AA seq 79 aa AA seqDB search MILDYINSRIKILWYTDPFLISREGVIVLETEKTFLIKLEEKNKFIRIFKAHGIFEITFK GKSFIIAGYKLVRKPWKRI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgattttagattacattaattctagaataaagattttatggtatacggatccttttcta atttctagagaaggtgttattgtattagagacggaaaaaacgtttttgattaaattagaa gagaagaacaagtttataaggatatttaaagctcatggtatatttgagataacttttaaa ggtaagtcttttataatagctggctataagctggtaagaaaaccttggaaaagaatttag

DBGET integrated database retrieval system