Saccharolobus solfataricus SARC-B: SULB_2233 Help Entry SULB_2233         CDS       T03911                                  Name (GenBank) toluene monooxygenase   KO K15763   toluene monooxygenase system protein D [EC:1.14.13.236 1.14.13.-] Organism ssol  Saccharolobus solfataricus SARC-B Pathway ssol00623   Toluene degradation ssol01100   Metabolic pathways ssol01120   Microbial metabolism in diverse environments ssol01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ssol00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00623 Toluene degradation     SULB_2233 Enzymes [BR:ssol01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.236  toluene 4-monooxygenase      SULB_2233 SSDB OrthologParalogGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  AKA74411 UniProt:  A4ZY70 LinkDB All DBs Position 2038661..2039008 Genome browser AA seq 115 aa AA seqDB search MSLELTLETILDKYQIMDLSKLPQNMVGPVLMKDEFSYAVVEALARDNPNTFKGVLDRGS YIRVVGERELILNKTTLEEVIGMDVRFPGEVEVRMSAFAGKIIVRGDYIKWHLDL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgagtttggagttaactcttgaaacaattttagataaatatcaaataatggatttaagt aaattaccacaaaatatggtagggccagtgctcatgaaagacgagttcagctatgctgta gttgaggctttagcgcgcgataatccaaatactttcaaaggagttcttgataggggttct tacataagagtagtgggtgaaagggaacttatcttaaacaagactacgctagaggaagtg ataggtatggacgttagatttcctggagaggttgaggtaaggatgagcgcatttgcagga aagataattgttagaggggattatataaaatggcatttagacttgtga

DBGET integrated database retrieval system