Shewanella spartinae: K0I31_01380 Help Entry K0I31_01380       CDS       T09209                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism sspa  Shewanella spartinae Brite KEGG Orthology (KO) [BR:sspa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sspa03036]     K0I31_01380 (zapB) Chromosome and associated proteins [BR:sspa03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     K0I31_01380 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA Nuf2_DHR10-like Rootletin Muted KIP1 CENP-Q FlaC_arch XRCC4_CC NPV_P10 SlyX DivIC Motif Other DBs NCBI-ProteinID:  QYJ94079 LinkDB All DBs Position complement(280805..281011) Genome browser AA seq 68 aa AA seqDB search MSLELLSKLETKIQAALETIELLKMELEEEKQKNHTLNEQNQQLSQDLTSWNEKVTGLVG LLNDEVSE NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgagccttgaactactgtccaagctggagacaaaaatccaagcggcactcgaaaccatt gagctactgaaaatggagcttgaagaagagaagcagaagaaccataccctgaacgaacaa aaccaacagctgagccaagatctcacctcttggaacgagaaagttaccgggcttgtgggt ctgctgaacgacgaagttagcgaataa

DBGET integrated database retrieval system