Shewanella spartinae: K0I31_06650 Help Entry K0I31_06650       CDS       T09209                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sspa  Shewanella spartinae Pathway sspa01100   Metabolic pathways sspa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0I31_06650    00074 Mycolic acid biosynthesis     K0I31_06650   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0I31_06650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QYJ95057 LinkDB All DBs Position complement(1508683..1508916) Genome browser AA seq 77 aa AA seqDB search MNKQEFLNALEEILELDENTLKGDEVLMDIEQWDSLAFLSVIAMADEHFDIVIQGDKLEE INTVGDLVSLVEEHLAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaagaatttttaaatgccctagaagagatccttgaactggacgagaatacg cttaagggggatgaggtcttgatggacatagagcaatgggattctttggcatttctaagc gtcatcgccatggccgatgagcacttcgatatagtgattcaaggtgacaagttagaagag atcaacactgtcggcgatcttgtcagtttagtagaagaacatctagccgcctaa

DBGET integrated database retrieval system