KEGG   Streptomyces spectabilis: CP982_00550
Entry
CP982_00550       CDS       T07323                                 

Symbol
speB
Name
(GenBank) agmatinase
  KO
K12676  proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
sspb  Streptomyces spectabilis
Pathway
sspb00331  Clavulanic acid biosynthesis
sspb01100  Metabolic pathways
sspb01110  Biosynthesis of secondary metabolites
Module
sspb_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sspb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    CP982_00550 (speB)
Enzymes [BR:sspb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.22  proclavaminate amidinohydrolase
     CP982_00550 (speB)
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-ProteinID: QEV57412
UniProt: A0A5P2X4S5
LinkDB
Position
134890..135840
AA seq 316 aa
MERIDITVSPRYAQIPTFMRLPYDPAPRGKDVVVIGAPYDGGTSYRPGARFGPRAVRSES
GLIHGVGIDRGPGTFDLIDCVDAGDIDLTPFNMHIAMATAQERLSGLLSDNAAFLMIGGD
HSLTLAALRAVASRHGPVAVLHLDAHSDTNPAFYGGEYHHGTPFRHAIEEKLVDPQRMVQ
IGIRGHNPRPDSLDFARGHGVRIVTADEFCALGPASTRQLVRARVGDAPLYVSVDIDVVD
PAFAPGTGTPAPGGPTSREVLALLRCVGGLHPVGLDVMEVSPLYDHGGITSVLATEIGAE
LLHQYACAHTRERTSP
NT seq 951 nt   +upstreamnt  +downstreamnt
gtggaacgcatcgacatcaccgtctcgccgcgttacgcccagatccccacgttcatgcgt
ctgccgtacgacccggcgccgcgcggaaaggacgtcgtggtcatcggcgccccctacgac
ggcggtaccagctaccggcccggcgcgcggttcggcccgcgcgccgtgcgcagcgagtcc
gggctcatccacggtgtggggatcgaccgcgggcccggcaccttcgacctcatcgactgc
gtcgacgccggcgacatcgacctgaccccgttcaacatgcacatcgccatggccaccgcg
caggagaggctcagcggcctgctctccgacaacgccgccttcctcatgatcggaggtgac
cactcgctcacccttgccgccctgcgcgccgtcgcctcccggcacggaccggtagccgtc
ctgcacctggacgcgcactccgacaccaaccccgccttctacggcggcgagtaccaccac
ggcacgcccttccggcacgcgatcgaggagaagctcgtcgacccgcagcgcatggtgcag
atcggcatccgcggccacaatccgcggcccgactccctggacttcgcccggggccacggg
gtgcggatcgtcaccgccgacgagttctgcgcgctgggtcccgcgagtacccggcagctg
gtccgcgcgcgcgtcggcgacgcgcccctctatgtgtcggtggacatcgacgtcgtggac
ccggcgttcgcccccggcaccggcacccccgcaccgggcggtcccacctcgcgcgaggtg
ctcgccctgctgcgctgcgtcgggggcctgcacccggtgggcctcgacgtcatggaggtc
tcgccgctgtacgaccacggcggcatcacgtccgtcctggccaccgagatcggcgcggag
ctgctccaccagtacgcctgcgcacacacccgagagaggacgtctccatga

DBGET integrated database retrieval system