Streptomyces spectabilis: CP982_14320 Help Entry CP982_14320       CDS       T07323                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism sspb  Streptomyces spectabilis Pathway sspb01051   Biosynthesis of ansamycins sspb01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:sspb00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     CP982_14320    01051 Biosynthesis of ansamycins     CP982_14320  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sspb01008]     CP982_14320 Polyketide biosynthesis proteins [BR:sspb01008]  Polyketide tailoring proteins   Others    CP982_14320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEV59766 UniProt:  A0A5P2XB28 LinkDB All DBs Position complement(3319798..3320073) Genome browser AA seq 91 aa AA seqDB search MTDSTTELPVAAIEQQIGAFLEAKTKMTWEPEVDLFASGAVSSLFAMELVVFVESTFDVE VEGPDLALDNFRTLRTMSALVTRLRVGGTGA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgacggactcgacaacggaactgcccgtcgccgccatcgagcagcagatcggcgcgttc cttgaggccaagaccaagatgacctgggagccggaggtggacctgttcgcctcgggagcg gtctcctcgctcttcgcgatggagctcgtggtgttcgtggagagcaccttcgacgtcgag gtggagggcccggacctcgccctggacaacttccgcaccctgcgcaccatgagcgcgctc gtgacccggctgcgcgtcgggggcaccggtgcttga

DBGET integrated database retrieval system