Streptomyces spectabilis: CP982_18995 Help Entry CP982_18995       CDS       T07323                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sspb  Streptomyces spectabilis Pathway sspb00253   Tetracycline biosynthesis sspb01056   Biosynthesis of type II polyketide backbone sspb01100   Metabolic pathways sspb01110   Biosynthesis of secondary metabolites Module sspb_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sspb00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP982_18995    00253 Tetracycline biosynthesis     CP982_18995  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sspb01004]     CP982_18995    01008 Polyketide biosynthesis proteins [BR:sspb01008]     CP982_18995 Lipid biosynthesis proteins [BR:sspb01004]  Polyketide synthase   Component type    CP982_18995 Polyketide biosynthesis proteins [BR:sspb01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP982_18995     Nonaketide PKS      CP982_18995     Decaketide PKS      CP982_18995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PRD_Mga Motif Other DBs NCBI-ProteinID:  QEV60553 UniProt:  A0A5P2X6D5 LinkDB All DBs Position complement(4396358..4396615) Genome browser AA seq 85 aa AA seqDB search MTAAPFTLDDLKRVLLEGSGAPEGVDLDAADVPDTEFEQLGYDSLALLETASRIEREYGI ELDESVVGDATTPRAFVAAVAAHAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccgccgcccccttcaccctcgacgacctcaagcgcgtgctgctcgaaggctccgga gcgcccgagggcgtggacctcgacgcggccgacgtccccgacacggagttcgagcagctc ggctacgactcgctggccctcctggagaccgcgagccgcatcgagcgcgagtacggcatc gaactcgacgagtcggtcgtcggcgacgcgaccaccccgcgcgccttcgtggcggccgtc gcggcccacgcggcctga

DBGET integrated database retrieval system