KEGG   Streptomyces spectabilis: CP982_34495
Entry
CP982_34495       CDS       T07323                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
sspb  Streptomyces spectabilis
Pathway
sspb00333  Prodigiosin biosynthesis
sspb01100  Metabolic pathways
sspb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sspb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CP982_34495
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: QEV63190
UniProt: A0A5P2XJK0
LinkDB
Position
7932753..7933991
AA seq 412 aa
MTADWTQAPGTAARAVPTDPGFEAALGAAVRVAALSPSSHNCQPWGVAWARGGGARAAAA
RAVTGAPGGDQYLVLALDRERRLRALPSLHGEMLVSCGAYGQLLLRALGAQGWAVDGLRF
APGGLDGPLEAGWPWPEPGPADWPRTWAPLCVARLRPAPGGTAEDLRALRDTAEARRTHR
APYRPQPVAPDVLDRLAAPSGTAVARDADVGVRHLTSDADRAALADFVARHAGRDFSHGP
AWRETHAYLRFSAADAAAHGDGFTLAELFGPLSRPGEWARRLALAPTTMRLLRHVGYPGL
LARQLARIVRPTPALTVLSLTGTPTPTLADGVKGGARLADYWLGATAEGLVLHPLSAVLQ
YDDLRHALEDRFRIPGQAIFLSRLGRPATDAAGVSGFPRSHRRPAHAPLRTI
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaccgctgactggacccaagcgcccgggacggccgcgcgcgccgtacccacggacccg
ggcttcgaggccgccctcggcgcggccgtgcgcgtcgccgcgctcagcccctcctcccac
aactgccagccctggggcgtggcctgggcccgcgggggcggggcccgggccgccgccgcg
cgggccgtgacgggggcgccgggcggcgaccagtacctcgtcctcgccctggaccgcgag
cggcggctgcgcgcgctgccctcgctccacggggagatgctggtcagctgtggcgcgtac
gggcaactgctgctgcgggcgctcggcgcgcaggggtgggccgtggacggcctccggttc
gcgcccggcggcctggacgggcccctggaggcgggctggccgtggccggagccgggcccc
gccgactggccccgcacctgggcgcccctgtgcgtggcccggctgcgccccgcgcccggg
ggcacggccgaggacctgcgcgctctgcgggacaccgcggaggcccgccgcacccaccgc
gccccctaccgcccgcagcccgtcgcaccggacgtcctggaccgcctcgcggcgccgtcg
ggcaccgccgtcgcgcgggacgcggacgtcggcgtgcgccatctgacgtcggacgccgac
cgcgccgcgctcgccgacttcgtcgcccggcacgcggggcgggacttcagccacggcccc
gcctggcgcgagacgcacgcgtatctgcggttcagcgccgcggacgccgccgcgcacggg
gacggcttcacgctcgcggagctgttcgggccgctgtcccggccgggggagtgggcgcgc
aggctcgcgctcgcgcccacgacgatgcgcctgctgcggcacgtcggctaccccggcctg
ctcgcccggcagctcgcgcgcatcgtgcgccccacgcccgccctgaccgtcctgagcctg
accggtacgcctacgccgacgctcgcggacggtgtcaagggcggggcacgactggccgat
tactggctgggcgccaccgcggaaggactggttctgcatcctctcagcgccgtactccag
tacgacgacctgcggcacgctctggaggatcggttccgcattccgggacaggcgattttc
ctcagcaggctgggccgccccgccacggatgcggcgggcgtatcggggttcccgcgctcc
caccgccgtcccgcccacgcgcccctgcggacgatctga

DBGET integrated database retrieval system