KEGG   Schlesneria sphaerica: ACGY09_11275
Entry
ACGY09_11275      CDS       T11240                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
sspe  Schlesneria sphaerica
Pathway
sspe03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sspe00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    ACGY09_11275 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sspe03011]
    ACGY09_11275 (rplR)
Ribosome [BR:sspe03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    ACGY09_11275 (rplR)
  Bacteria
    ACGY09_11275 (rplR)
  Archaea
    ACGY09_11275 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p adh_short MobC_2
Other DBs
NCBI-ProteinID: XJS18092
LinkDB
Position
complement(3109898..3110260)
AA seq 120 aa
MNGQEIIATQRRRRQFRVRNRLKSGRPRLSVFRSGRHIYAQVIDDATGQTLASASSLDTA
LRGKVTSGGNCAGAEVIGREIAERALAKGIKAVSYDRGPYRFHGRLAKLAEAARAAGLDF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaacggtcaggaaatcatcgcgacgcaacgtcgccgtcgtcagtttcgggtacgaaac
cgactgaaaagcggtcgtccccgcttgtctgtcttccgcagcggtcgtcacatttacgcc
caggtgatcgacgacgcgaccggtcagacgctggcatcggcttcgtcactggataccgcg
ctccgtggtaaggttaccagcggtggcaactgtgccggagcagaagtgattggacgcgag
atcgccgagcgggcgctggccaaagggattaaggccgtttcttatgatcgtggcccttac
cggttccatggtcgtctggcgaagttggcagaagcagcccgtgctgctgggttggatttc
taa

DBGET integrated database retrieval system