Sporomusa sphaeroides: SPSPH_016030 Help Entry SPSPH_016030      CDS       T10405                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ssph  Sporomusa sphaeroides Pathway ssph00020   Citrate cycle (TCA cycle) ssph00720   Other carbon fixation pathways ssph01100   Metabolic pathways ssph01110   Biosynthesis of secondary metabolites ssph01120   Microbial metabolism in diverse environments ssph01200   Carbon metabolism ssph01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ssph00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SPSPH_016030   09102 Energy metabolism    00720 Other carbon fixation pathways     SPSPH_016030 Enzymes [BR:ssph01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SPSPH_016030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_9 Fer4_21 Fer4_6 Fer4_2 Fer4_16 Fer4_4 Fer4_8 Fer4_15 Fer4_13 Fer4_17 Fer4_22 Fer4_3 Motif Other DBs NCBI-ProteinID:  WXA38892 LinkDB All DBs Position 1775705..1775929 Genome browser AA seq 74 aa AA seqDB search MALAIKPKLCKGCGICVHFCPKAVLDLDEMGKIYAKDPDKCIICGQCELRCPDYAIKVTK EEKTSTKTDGGAAK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcactggctattaaaccaaagctatgtaaaggctgtggtatctgtgtgcatttttgt cctaaagccgttctggatttagacgaaatgggcaaaatctatgcaaaagatccagataaa tgtattatctgtggtcaatgcgagctgcgttgcccggattatgcgattaaagtaaccaaa gaagaaaaaaccagtacgaaaaccgatgggggggctgccaagtga

DBGET integrated database retrieval system