Salvia splendens (scarlet sage): 121743776 Help Entry 121743776         CDS       T07627                                  Name (RefSeq) rac-like GTP-binding protein 7   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04145   Phagosome sspl04148   Efferocytosis sspl04517   IgSF CAM signaling sspl04518   Integrin signaling sspl04620   Toll-like receptor signaling pathway sspl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121743776    04518 Integrin signaling     121743776  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121743776    04148 Efferocytosis     121743776  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121743776  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121743776  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121743776   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121743776    04031 GTP-binding proteins [BR:sspl04031]     121743776 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121743776  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121743776   Macropinocytosis    Ras GTPases     121743776  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121743776 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121743776   Exosomal proteins of other body fluids (saliva and urine)    121743776   Exosomal proteins of colorectal cancer cells    121743776   Exosomal proteins of bladder cancer cells    121743776 GTP-binding proteins [BR:sspl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121743776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA Sua5_C Motif Other DBs NCBI-GeneID:  121743776 NCBI-ProteinID:  XP_041993078 LinkDB All DBs Position 8:complement(30872737..30874626) Genome browser AA seq 165 aa AA seqDB search MSTAKFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNIGLWD TAGQEEFLLAFSLISKASYENIYKKWIPELRHYSPTMPIVLVGTKMDLREDKQFLINHPA AHPITNAQGEELKKMIGAVAYIECSAKTQQNVKDVFDTDGVRTKP NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgagtacggctaagttcatcaagtgtgtgaccgtgggcgacggcgccgtcgggaagact tgcatgctcatttcttacacgagtaatactttcccaacggattatgttccgactgtgttc gacaactttagcgccaacgtcgtcgtcgatggaaacacagtcaacattggcctatgggat accgcagggcaagaagagtttttacttgcattttctctcatcagcaaagctagctatgag aacatatacaagaaatggattccagagttaaggcactattctccaactatgcctattgtg cttgttggaaccaaaatggatttgagagaagataagcaatttctaatcaaccatccagct gctcatccaataacaaatgcgcagggagaagaactgaagaagatgatcggagcagtagct tatatagagtgtagtgcaaaaactcaacagaacgtgaaagatgtgtttgacactgatggg gtacgaactaaaccctaa

DBGET integrated database retrieval system