Salvia splendens (scarlet sage): 121746831 Help Entry 121746831         CDS       T07627                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04145   Phagosome sspl04148   Efferocytosis sspl04517   IgSF CAM signaling sspl04518   Integrin signaling sspl04620   Toll-like receptor signaling pathway sspl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121746831    04518 Integrin signaling     121746831  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121746831    04148 Efferocytosis     121746831  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121746831  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121746831  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121746831   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121746831    04031 GTP-binding proteins [BR:sspl04031]     121746831 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121746831  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121746831   Macropinocytosis    Ras GTPases     121746831  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121746831 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121746831   Exosomal proteins of other body fluids (saliva and urine)    121746831   Exosomal proteins of colorectal cancer cells    121746831   Exosomal proteins of bladder cancer cells    121746831 GTP-binding proteins [BR:sspl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121746831 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ParE-like_toxin DUF2951 Sua5_C GyrB_insert AAA_7 HARP Motif Other DBs NCBI-GeneID:  121746831 NCBI-ProteinID:  XP_041996703 LinkDB All DBs Position 9:16445489..16446878 Genome browser AA seq 200 aa AA seqDB search MSASSYRFIKCVTVGDGGVGKTCLLISYTTNSFPTGYIPTVFDNFSVNMTVGGSSVNLSL WDSAGQEDYNRLRPLSYHGANVFILVFSLISKTSYDSVHNKWNSELRHYAPNVPIILVGS KTDLRDDKQFFVDDTEAVPISTAEGEELKKMIGASAYIECSSKTQQNVKAVFDEAINVIL QQPKQGKKKKRKGQQNCRIL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctctagttataggttcataaaatgcgtcaccgtcggcgacggaggcgttggt aaaacttgcttgctcatttcctacaccaccaactcctttcctacgggttacatcccaact gtatttgacaattttagtgtgaatatgacggtgggtgggagcagtgttaatctatcgctg tgggactctgctggtcaggaggattacaatagattaagaccgctaagctaccatggagct aatgtgtttatacttgtattctctcttatttccaagactagttatgacagtgtccacaac aagtggaattctgagttgaggcattatgctcctaatgttccgataattcttgtgggatca aagactgatcttcgagatgataaacagttctttgtcgacgacactgaggcagtacccatt tcaactgcagagggagaggagctcaagaaaatgattggagcatcagcttacattgaatgt agttccaagacacaacagaatgtgaaggctgtctttgatgaagctatcaatgtcattttg cagcaaccaaaacaaggaaagaaaaagaagagaaagggccaacaaaactgcagaatactg tga

DBGET integrated database retrieval system