Salvia splendens (scarlet sage): 121746831 Help Entry 121746831         CDS       T07627                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04145   Phagosome sspl04148   Efferocytosis sspl04620   Toll-like receptor signaling pathway sspl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sspl00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121746831    04148 Efferocytosis     121746831  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121746831  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121746831  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121746831   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121746831    04031 GTP-binding proteins [BR:sspl04031]     121746831 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121746831  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121746831   Macropinocytosis    Ras GTPases     121746831  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121746831 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121746831   Exosomal proteins of other body fluids (saliva and urine)    121746831   Exosomal proteins of colorectal cancer cells    121746831   Exosomal proteins of bladder cancer cells    121746831 GTP-binding proteins [BR:sspl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121746831 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf ParE-like_toxin GTP_EFTU DUF2951 Sua5_C GyrB_insert AAA_7 HARP Motif Other DBs NCBI-GeneID:  121746831 NCBI-ProteinID:  XP_041996703 LinkDB All DBs Position 9:16445489..16446878 Genome browser AA seq 200 aa AA seqDB search MSASSYRFIKCVTVGDGGVGKTCLLISYTTNSFPTGYIPTVFDNFSVNMTVGGSSVNLSL WDSAGQEDYNRLRPLSYHGANVFILVFSLISKTSYDSVHNKWNSELRHYAPNVPIILVGS KTDLRDDKQFFVDDTEAVPISTAEGEELKKMIGASAYIECSSKTQQNVKAVFDEAINVIL QQPKQGKKKKRKGQQNCRIL NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctctagttataggttcataaaatgcgtcaccgtcggcgacggaggcgttggt aaaacttgcttgctcatttcctacaccaccaactcctttcctacgggttacatcccaact gtatttgacaattttagtgtgaatatgacggtgggtgggagcagtgttaatctatcgctg tgggactctgctggtcaggaggattacaatagattaagaccgctaagctaccatggagct aatgtgtttatacttgtattctctcttatttccaagactagttatgacagtgtccacaac aagtggaattctgagttgaggcattatgctcctaatgttccgataattcttgtgggatca aagactgatcttcgagatgataaacagttctttgtcgacgacactgaggcagtacccatt tcaactgcagagggagaggagctcaagaaaatgattggagcatcagcttacattgaatgt agttccaagacacaacagaatgtgaaggctgtctttgatgaagctatcaatgtcattttg cagcaaccaaaacaaggaaagaaaaagaagagaaagggccaacaaaactgcagaatactg tga

DBGET integrated database retrieval system