Salvia splendens (scarlet sage): 121757053 Help Entry 121757053         CDS       T07627                                  Name (RefSeq) sm-like protein LSM7 isoform X1   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl03018   RNA degradation sspl03040   Spliceosome Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     121757053   09123 Folding, sorting and degradation    03018 RNA degradation     121757053  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sspl03019]     121757053    03041 Spliceosome [BR:sspl03041]     121757053 Messenger RNA biogenesis [BR:sspl03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      121757053   mRNA degradation factors    5'-3' decay     Lsm complex      121757053 Spliceosome [BR:sspl03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     121757053 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM KNOX2 Motif Other DBs NCBI-GeneID:  121757053 NCBI-ProteinID:  XP_042008465 LinkDB All DBs Position 1:complement(46981291..46985637) Genome browser AA seq 112 aa AA seqDB search MSGRKETVLDLAKFVDKGVQVKLTGARLVTETLKGYDQLLNLVLDEAVEFLRDPEDPLKT TDQTRLLGLIIPLLLYFISRVTRPLLFLLCFILSLKPYTIIPSVASFTTHFF NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtctggcagaaaggaaaccgttctggacctggctaagtttgtcgacaagggtgtccaa gtaaaactaactggtgcaagactagtgaccgaaactcttaaaggctatgaccaattgctc aatcttgttttggatgaagcagtagaatttcttagggatccagaagatcccctgaagaca actgatcagacccgtcttcttggcttaataatccccttgctactgtatttcatctcaaga gtcacgaggcccctactctttttattgtgtttcatactttcactaaagccctacactatt atcccctctgtggcatcatttacaacacatttcttttga

DBGET integrated database retrieval system