Salvia splendens (scarlet sage): 121760149 Help Entry 121760149         CDS       T07627                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04145   Phagosome sspl04148   Efferocytosis sspl04517   IgSF CAM signaling sspl04518   Integrin signaling sspl04620   Toll-like receptor signaling pathway sspl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121760149    04518 Integrin signaling     121760149  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121760149    04148 Efferocytosis     121760149  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121760149  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121760149  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121760149   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121760149    04031 GTP-binding proteins [BR:sspl04031]     121760149 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121760149  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121760149   Macropinocytosis    Ras GTPases     121760149  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121760149 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121760149   Exosomal proteins of other body fluids (saliva and urine)    121760149   Exosomal proteins of colorectal cancer cells    121760149   Exosomal proteins of bladder cancer cells    121760149 GTP-binding proteins [BR:sspl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121760149 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Sua5_C AAA_7 Motif Other DBs NCBI-GeneID:  121760149 NCBI-ProteinID:  XP_042011702 LinkDB All DBs Position 13:complement(4469967..4472373) Genome browser AA seq 214 aa AA seqDB search MSANNSTTSSGGAAANANATATKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDN FSANVSVDGQTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVP ELRHYAPSVPIVLVGTKLDLREDKQFKKDYPGASTISTEQGEELRKQIGAVAYIECSAKT QQNVKGVFDAAIKVVLRPPKLKKHKRRYTSCRLL NT seq 645 nt NT seq  +upstreamnt  +downstreamnt atgagtgctaataatagtactacaagtagtggtggcgctgctgcaaatgcaaatgccaca gccaccaaattcatcaaatgtgtcactgttggtgatggtgcagttgggaagacatgcctt ctcatctcctacaccagcaacactttcccaacggattatgtgcctactgtgtttgataat ttcagtgcaaatgtgagtgttgatgggcagactgtgaatcttggcttgtgggatactgct ggccaagaagactacaacagattgaggcctctcagttacagaggggcagatgtgttcctc ctggctttctctctcataagtaggccaagctttgaaaacatttcaaagaaatgggtcccg gagttgcggcactatgccccctcagtacccattgttcttgtggggacaaagctagatcta agagaggacaaacaattcaaaaaggattatccgggggcaagcactatttcgacagaacag ggtgaagagctcagaaagcaaattggagcggtggcctatatcgaatgcagtgccaagaca cagcagaatgtgaagggtgtgtttgatgcagcgataaaagtagttctgcggccacctaaa ctcaagaaacacaagagaaggtatacatcgtgtcgcctactttga

DBGET integrated database retrieval system