Salvia splendens (scarlet sage): 121763074 Help Entry 121763074         CDS       T07627                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04145   Phagosome sspl04148   Efferocytosis sspl04517   IgSF CAM signaling sspl04518   Integrin signaling sspl04620   Toll-like receptor signaling pathway sspl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121763074    04518 Integrin signaling     121763074  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121763074    04148 Efferocytosis     121763074  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121763074  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121763074  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121763074   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121763074    04031 GTP-binding proteins [BR:sspl04031]     121763074 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121763074  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121763074   Macropinocytosis    Ras GTPases     121763074  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121763074 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121763074   Exosomal proteins of other body fluids (saliva and urine)    121763074   Exosomal proteins of colorectal cancer cells    121763074   Exosomal proteins of bladder cancer cells    121763074 GTP-binding proteins [BR:sspl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121763074 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  121763074 NCBI-ProteinID:  XP_042015069 LinkDB All DBs Position 13:23170958..23174424 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPITTAQGDDLKKSIGAAAYIECSAKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtctagatttattaagtgcgtgaccgtgggcgacggggctgtgggtaaaaca tgtctgctcatttcttacactagcaacacttttccaacggattatgtccctactgttttc gataatttcagtgccaatgtcgtagtggatggtagcactgttaatctgggattgtgggat actgcaggtcaagaggattacaatagattgagaccattgagctaccgtggggctgatgtc tttatactcgccttctctcttattagcaaggcaagttacgagaatgtctccaagaagtgg atacctgaattaaggcattatgctcccggagttccaataatccttgtggggacaaagctc gatcttcgagaggataagcagtttttcgtggaccaccccggagcagtgcccatcacaaca gcacagggagatgacttgaagaaatcaattggagctgctgcttacattgaatgcagtgct aagacacaacagaatgtgaaggctgtctttgatgcagcgataaaggttgttctgcagcca cccaagcaaaagaagaaaaagaagagaaagggtcaaaaagcatgcagcatattataa

DBGET integrated database retrieval system