Salvia splendens (scarlet sage): 121767169 Help Entry 121767169         CDS       T07627                                  Name (RefSeq) glutaredoxin-C3-like   KO K00128   aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] Organism sspl  Salvia splendens (scarlet sage) Pathway sspl00010   Glycolysis / Gluconeogenesis sspl00053   Ascorbate and aldarate metabolism sspl00071   Fatty acid degradation sspl00280   Valine, leucine and isoleucine degradation sspl00310   Lysine degradation sspl00330   Arginine and proline metabolism sspl00340   Histidine metabolism sspl00380   Tryptophan metabolism sspl00410   beta-Alanine metabolism sspl00561   Glycerolipid metabolism sspl00620   Pyruvate metabolism sspl00770   Pantothenate and CoA biosynthesis sspl01100   Metabolic pathways sspl01110   Biosynthesis of secondary metabolites sspl01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:sspl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     121767169    00053 Ascorbate and aldarate metabolism     121767169    00620 Pyruvate metabolism     121767169   09103 Lipid metabolism    00071 Fatty acid degradation     121767169    00561 Glycerolipid metabolism     121767169   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     121767169    00310 Lysine degradation     121767169    00330 Arginine and proline metabolism     121767169    00340 Histidine metabolism     121767169    00380 Tryptophan metabolism     121767169   09106 Metabolism of other amino acids    00410 beta-Alanine metabolism     121767169   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     121767169   09109 Metabolism of terpenoids and polyketides    00903 Limonene degradation     121767169 Enzymes [BR:sspl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.1  With NAD+ or NADP+ as acceptor     1.2.1.3  aldehyde dehydrogenase (NAD+)      121767169 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 DSBA GST_N_3 Motif Other DBs NCBI-GeneID:  121767169 NCBI-ProteinID:  XP_042019309 LinkDB All DBs Position 15:complement(17532765..17534489) Genome browser AA seq 194 aa AA seqDB search MNASSKPLQLVHLPSSTRLSTRSNFYRGVNFLPRRVNLQLSCSCERQLKRESGNDAVAGE LMMFGASLQRRSALIAAVACILVIGNAPHKTLASNSPSAFVENVIYSNKIAIFSKSYCPY SLRAKHVFSELEEQPYVVELDLRDDGYKIQDVLLELVGRRTVPQVFVNGKHIGGSDDLQA AVKSGKLQSLLSKD NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgaacgcttcgtcaaagccccttcagctggtccacttaccttcttcaacgcggctctct acacgctccaatttctacagaggtgtgaattttcttccgaggagggttaatctgcaattg agctgtagctgcgaacgccagctgaaaagggagagtggaaacgacgccgttgcgggagag ttgatgatgtttggagctagtttgcagcggcgatcagctctgattgccgcggtggcttgt attttggtgatcggcaatgcgccgcataaaaccctagcttccaattcgccgtcggctttt gtcgaaaatgtcatttattccaataaaattgccattttctccaaatcatattgcccatat tccttgcgagccaagcacgtatttagtgaactcgaggagcagccgtatgtcgtggagctt gatcttcgggatgatggatataagattcaggacgttctcctggaattggttgggcgacga actgtcccacaagtgtttgtaaatgggaagcatattggcggttctgatgatctgcaagct gctgtcaaaagtggtaaactgcagagcctactcagtaaagattga

DBGET integrated database retrieval system