Salvia splendens (scarlet sage): 121774019
Help
Entry
121774019 CDS
T07627
Name
(RefSeq) SKP1-like protein 20
KO
K03094
S-phase kinase-associated protein 1
Organism
sspl
Salvia splendens (scarlet sage)
Pathway
sspl03083
Polycomb repressive complex
sspl04120
Ubiquitin mediated proteolysis
sspl04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
sspl00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
121774019
04120 Ubiquitin mediated proteolysis
121774019
09126 Chromosome
03083 Polycomb repressive complex
121774019
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
sspl04131
]
121774019
04121 Ubiquitin system [BR:
sspl04121
]
121774019
03036 Chromosome and associated proteins [BR:
sspl03036
]
121774019
Membrane trafficking [BR:
sspl04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
121774019
Ubiquitin system [BR:
sspl04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
121774019
Cul7 complex
121774019
Chromosome and associated proteins [BR:
sspl03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
121774019
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
121774019
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BTB
Motif
Other DBs
NCBI-GeneID:
121774019
NCBI-ProteinID:
XP_042026869
LinkDB
All DBs
Position
17:complement(16706566..16709198)
Genome browser
AA seq
83 aa
AA seq
DB search
MIRHIIEDGCAGTSIPLPNVTAKILSKVIEAFHAEFVKENQGILLDLIMVAANYLDIKIL
LELTCQTVADMIKGKTPEESARL
NT seq
252 nt
NT seq
+upstream
nt +downstream
nt
atgattaggcacataatcgaggatggttgcgccggcaccagcatcccgctacccaacgtc
actgccaagatcctctcgaaggtgatcgaagcgttccacgctgagttcgtcaaagaaaat
caaggaatactcttggacctcatcatggtagctgcgaactacctagacatcaagatcctt
ctcgagctcacgtgccaaactgtagcggatatgatcaagggaaagactcctgaggaatcc
gcaagactttaa
DBGET
integrated database retrieval system