Salvia splendens (scarlet sage): 121779200 Help Entry 121779200         CDS       T07627                                  Name (RefSeq) SKP1-like protein 12   KO K03094   S-phase kinase-associated protein 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl03083   Polycomb repressive complex sspl04120   Ubiquitin mediated proteolysis sspl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121779200    04120 Ubiquitin mediated proteolysis     121779200   09126 Chromosome    03083 Polycomb repressive complex     121779200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121779200    04121 Ubiquitin system [BR:sspl04121]     121779200    03036 Chromosome and associated proteins [BR:sspl03036]     121779200 Membrane trafficking [BR:sspl04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     121779200 Ubiquitin system [BR:sspl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      121779200    Cul7 complex      121779200 Chromosome and associated proteins [BR:sspl03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      121779200   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      121779200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  121779200 NCBI-ProteinID:  XP_042032457 LinkDB All DBs Position 19:complement(23797618..23798084) Genome browser AA seq 121 aa AA seqDB search MAKTVILVSSDGKWFEIAESMAAQSIVIGNVIEYVGGGDPIPLFNVTARVLIKVIPQESR RWKVLLECMKAANYLNIEGLFDLISQKIADSIEACKSEAEMVYDFSPERRRANTCACIGL V NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggcgaaaaccgtaatcttagtgagctccgacggcaagtggttcgagatcgctgaatcc atggcggcgcagtcaatagtgatcgggaacgtaatcgaatacgtcggtggcggcgacccg atcccgctcttcaacgtcaccgctagagtcctaattaaggtgatccctcaagaatcacgg cggtggaaagtgctcttggagtgtatgaaggccgcaaactatctcaacatcgaaggtctg tttgatctcatctcgcagaagatcgctgattcgatcgaagcctgcaaatcggaggcggag atggtgtacgatttctcgccggagaggaggcgagcaaatacgtgtgcgtgtattggcttg gtgtaa

DBGET integrated database retrieval system