Salvia splendens (scarlet sage): 121780448 Help Entry 121780448         CDS       T07627                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04145   Phagosome sspl04148   Efferocytosis sspl04620   Toll-like receptor signaling pathway sspl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sspl00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121780448    04148 Efferocytosis     121780448  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121780448  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121780448  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121780448   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121780448    04031 GTP-binding proteins [BR:sspl04031]     121780448 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121780448  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121780448   Macropinocytosis    Ras GTPases     121780448  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121780448 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121780448   Exosomal proteins of other body fluids (saliva and urine)    121780448   Exosomal proteins of colorectal cancer cells    121780448   Exosomal proteins of bladder cancer cells    121780448 GTP-binding proteins [BR:sspl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121780448 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  121780448 NCBI-ProteinID:  XP_042034016 LinkDB All DBs Position 19:complement(5984706..5987371) Genome browser AA seq 196 aa AA seqDB search MSATRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFIIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKGVFDAAIKIVLQP PKQKKKKKGHRGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagtgcaacgagattcatcaagtgtgtgactgtgggtgatggagctgttggaaaaact tgcatgttgatttcttacaccagcaacacatttcctacggattatgttccgactgttttt gataacttcagcgctaatgtagttgtggatggtaatactgtaaacctgggactctgggat actgcaggccaggaggattataatagattaagacccttgagttatcgtggagctgatgtt ttccttctagccttttctctcattagcaaggctagctacgaaaatattgcaaagaagtgg attcccgagttgaggcattacgcgccaggtgttccaattattcttgttggaacgaagctt gatcttagagatgataaacagttcatcatcgatcatcctggagcagttccgataactaca gctcagggggaggaactcaagaagctaattggagctcctgcgtacattgagtgcagctcg aaaacacaacagaatgtgaagggtgtgtttgatgcagccattaaaatagtattgcagcca ccaaaacagaagaagaaaaagaaggggcacagaggctgctccattttgtaa

DBGET integrated database retrieval system