Salvia splendens (scarlet sage): 121782405 Help Entry 121782405         CDS       T07627                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04145   Phagosome sspl04148   Efferocytosis sspl04517   IgSF CAM signaling sspl04518   Integrin signaling sspl04620   Toll-like receptor signaling pathway sspl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sspl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     121782405    04518 Integrin signaling     121782405  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     121782405    04148 Efferocytosis     121782405  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     121782405  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     121782405  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121782405   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121782405    04031 GTP-binding proteins [BR:sspl04031]     121782405 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     121782405  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     121782405   Macropinocytosis    Ras GTPases     121782405  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     121782405 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121782405   Exosomal proteins of other body fluids (saliva and urine)    121782405   Exosomal proteins of colorectal cancer cells    121782405   Exosomal proteins of bladder cancer cells    121782405 GTP-binding proteins [BR:sspl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     121782405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  121782405 NCBI-ProteinID:  XP_042036163 LinkDB All DBs Position 20:1859639..1862339 Genome browser AA seq 196 aa AA seqDB search MSATRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQQNVKGVFDAAIKIVLQP PKQKKKKKGHRGCSIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagtgcaaccagattcatcaagtgtgtgactgtgggtgatggtgctgttggaaaaact tgcatgttgatctcttacaccagcaacacatttcctacggattatgttccgactgttttt gataacttcagcgctaatgtagttgtggatggtaatactgtaaacctgggactctgggat actgcaggccaggaggattataatagattaagacccttgagttatcgtggagctgatgtt ttccttctagccttttctctcattagcaaggctagctacgaaaatattgccaagaagtgg attcctgagttgaggcattacgcgccaggtgttccaatcattcttgttggaacgaagctt gatcttagagatgataaacagttcttcatcgatcatccaggagcagttccgataactaca gctcagggggaggaactcaagaagctaattggagctcctgcgtacattgagtgcagctcg aaaacacaacagaatgtgaagggtgtgtttgatgcagccattaaaatagtactgcagccg ccaaaacagaagaagaaaaagaaggggcacagaggctgctccattttgtaa

DBGET integrated database retrieval system