Salvia splendens (scarlet sage): 121799115 Help Entry 121799115         CDS       T07627                                  Name (RefSeq) calmodulin-like isoform X1   KO K02183   calmodulin Organism sspl  Salvia splendens (scarlet sage) Pathway sspl04016   MAPK signaling pathway - plant sspl04070   Phosphatidylinositol signaling system sspl04075   Plant hormone signal transduction sspl04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sspl00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     121799115    04070 Phosphatidylinositol signaling system     121799115    04075 Plant hormone signal transduction     121799115  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     121799115  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sspl01009]     121799115   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sspl04131]     121799115    03036 Chromosome and associated proteins [BR:sspl03036]     121799115   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sspl04147]     121799115 Protein phosphatases and associated proteins [BR:sspl01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121799115 Membrane trafficking [BR:sspl04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121799115 Chromosome and associated proteins [BR:sspl03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121799115 Exosome [BR:sspl04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121799115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 TerB SPEF2_C EF_EFCAB10_C DUF5580_M RB_A RNA_pol_Rpb4 Phage_TAC_12 AAA_13 PA_Ig-like DUF3349 DUF5827 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  121799115 NCBI-ProteinID:  XP_042054391 LinkDB All DBs Position 4:complement(12127139..12128742) Genome browser AA seq 152 aa AA seqDB search MADALTEEQIAEFREAFSLIDKDSDGMITVEELATVIQSLNEHPTKEEIQEMMNEVDADG DGTVDFEEFLSIMARKMKENVAEELKEAFKVFDRDQDGFISAIELRNVMLNLGERLSDEE AEQMIREADLDGDGLVSYEEFVRMMMASAANC NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggctgatgcattgacagaggagcagattgctgagttccgtgaggctttctctctcatc gataaagattccgatgggatgatcacagtggaagaattggcaacagtgattcaatctctg aatgagcatccaacaaaagaagaaattcaagaaatgatgaatgaggttgatgcagatgga gatggcactgtggatttcgaggaatttttgagtattatggcaagaaaaatgaaggaaaat gttgcagaggaactgaaagaagctttcaaagttttcgatcgagatcaagatggattcata tcagcaattgagttgaggaatgtgatgctgaatctcggagaaagattaagtgatgaagaa gctgaacaaatgataagagaagctgatttagatggggatgggcttgttagctatgaagaa tttgtgaggatgatgatggcttctgcagctaattgctag

DBGET integrated database retrieval system