Salvia splendens (scarlet sage): 121806977 Help Entry 121806977         CDS       T07627                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism sspl  Salvia splendens (scarlet sage) Pathway sspl03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     121806977  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sspl03400]     121806977 DNA repair and recombination proteins [BR:sspl03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      121806977 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  121806977 NCBI-ProteinID:  XP_042063094 LinkDB All DBs Position 6:complement(11434646..11436341) Genome browser AA seq 102 aa AA seqDB search MEEKTFDPDLIRAIFKLVWEKRGAEREKNQLSENEAEAGPSTTKRSRQIPANGNALKLSC ELLRVFVAEAIQRAAAIAEAEGSLKIEATHLERILPQLLLDF NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggaggaaaaaacattcgatccggatttaattcgcgctattttcaaactcgtctgggaa aaacgaggagcagagcgggagaagaatcaactctcagaaaatgaagcagaggctggacca agtacgacgaagagaagcaggcaaattcctgccaacgggaatgcattgaagctgagctgt gaactcctccgagtttttgtggcagaggctatccagcgtgctgctgccattgctgaagca gagggctcattgaaaatagaagcaactcatctagaaaggatacttcctcaattactttta gacttttga

DBGET integrated database retrieval system