Streptomyces spongiicola: DDQ41_05740 Help Entry DDQ41_05740       CDS       T06937                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sspo  Streptomyces spongiicola Pathway sspo00998   Biosynthesis of various antibiotics sspo01100   Metabolic pathways sspo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DDQ41_05740    00074 Mycolic acid biosynthesis     DDQ41_05740   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DDQ41_05740 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AWK08515 UniProt:  A0A2S1YWQ2 LinkDB All DBs Position 1324584..1324832 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVEGLAEIVNEIAGIPAEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAAEYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcgaaggtctcgccgagatcgtcaacgagatcgcc ggtatcccggcggaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccg gacgaggacgtcaagaacctcaagaccgtcggcgacgctgccgagtacatcctgaagcac caggcctga

DBGET integrated database retrieval system