Streptomyces spongiicola: DDQ41_07360 Help Entry DDQ41_07360       CDS       T06937                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sspo  Streptomyces spongiicola Pathway sspo00253   Tetracycline biosynthesis sspo01056   Biosynthesis of type II polyketide backbone sspo01100   Metabolic pathways sspo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sspo00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     DDQ41_07360    00253 Tetracycline biosynthesis     DDQ41_07360  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sspo01004]     DDQ41_07360    01008 Polyketide biosynthesis proteins [BR:sspo01008]     DDQ41_07360 Lipid biosynthesis proteins [BR:sspo01004]  Polyketide synthase   Component type    DDQ41_07360 Polyketide biosynthesis proteins [BR:sspo01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      DDQ41_07360     Nonaketide PKS      DDQ41_07360     Decaketide PKS      DDQ41_07360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  AWK08768 LinkDB All DBs Position 1712710..1712961 Genome browser AA seq 83 aa AA seqDB search MSSSMTFGDLKAIMGRCTGDIEELTEDHLGTAFTDLGYDSLAVLEIASQIQREYGLQIPD EAIEDMTSPQSVIDYVNTGLAAV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcagcagcatgaccttcggcgacctcaaggcgatcatgggcaggtgcaccggtgac atcgaggagctcaccgaggaccacctcggcaccgccttcaccgacctcggctacgactcg ctcgccgtgctggagatcgccagccagatccagcgggagtacggcctgcagataccggac gaggccatcgaggacatgacctcgccccagagcgtgatcgactacgtcaacaccggcctc gcggcggtctga

DBGET integrated database retrieval system