Streptomyces spongiicola: DDQ41_21835 Help Entry DDQ41_21835       CDS       T06937                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism sspo  Streptomyces spongiicola Pathway sspo00074   Mycolic acid biosynthesis sspo00280   Valine, leucine and isoleucine degradation sspo00630   Glyoxylate and dicarboxylate metabolism sspo00640   Propanoate metabolism sspo01100   Metabolic pathways sspo01110   Biosynthesis of secondary metabolites sspo01120   Microbial metabolism in diverse environments sspo01200   Carbon metabolism Module sspo_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:sspo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     DDQ41_21835    00640 Propanoate metabolism     DDQ41_21835   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     DDQ41_21835   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     DDQ41_21835 SSDB OrthologParalogGFIT Motif Pfam:  ACC_epsilon LppA Motif Other DBs NCBI-ProteinID:  AWK11117 UniProt:  A0A2S1Z421 LinkDB All DBs Position complement(4957133..4957339) Genome browser AA seq 68 aa AA seqDB search MIKVVRGNPTPEELAAALAVVQARAAATASAVSGAPLPPEEWSDPARIARARALRPGPRS WSRTYWPG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgatcaaggtcgtacggggtaaccccaccccggaggagctggccgccgccctggcggtg gtccaggcccgcgccgcggcgacggcctccgccgtgtccggcgcgccgctgccgcccgag gagtggtcggacccggcccgtatcgcgcgggcgcgggcgctgcggcccgggccgcggtcg tggtcccgcacgtactggccgggctga

DBGET integrated database retrieval system