Solanum stenotomum: 125847408 Help Entry 125847408         CDS       T08385                                  Name (RefSeq) SKP1-like protein 5   KO K03094   S-phase kinase-associated protein 1 Organism sstn  Solanum stenotomum Pathway sstn03083   Polycomb repressive complex sstn04120   Ubiquitin mediated proteolysis sstn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sstn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125847408    04120 Ubiquitin mediated proteolysis     125847408   09126 Chromosome    03083 Polycomb repressive complex     125847408  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sstn04131]     125847408    04121 Ubiquitin system [BR:sstn04121]     125847408    03036 Chromosome and associated proteins [BR:sstn03036]     125847408 Membrane trafficking [BR:sstn04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     125847408 Ubiquitin system [BR:sstn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      125847408    Cul7 complex      125847408 Chromosome and associated proteins [BR:sstn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      125847408   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      125847408 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 DUF6694 Motif Other DBs NCBI-GeneID:  125847408 NCBI-ProteinID:  XP_049382989 LinkDB All DBs Position 12:37092107..37092403 Genome browser AA seq 98 aa AA seqDB search MTTVVKYWKKHSEEGGTEDQLKNFDQDFLKMSHSELLGVVLAARYLDDKQLKKVIIQEFV DRITGKTLKEIQEVYGIVNAYTSEEEEEVRREYAWAFE NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacgacagtggttaaatattggaagaagcattcggaagaaggtggtacggaagatcag ctaaagaattttgatcaggatttcttgaagatgagtcactcagaattattgggtgttgtc ttggctgctagatatcttgatgataaacagttgaagaaggtaataatccaagaatttgtt gatagaatcacagggaaaacactaaaggaaatacaagaagtatatggcattgtgaatgct tatacatcagaggaagaggaggaggtccgtagagagtatgcttgggcttttgaatga

DBGET integrated database retrieval system