Solanum stenotomum: 125854941 Help Entry 125854941         CDS       T08385                                  Name (RefSeq) calmodulin-2/4-like   KO K02183   calmodulin Organism sstn  Solanum stenotomum Pathway sstn04016   MAPK signaling pathway - plant sstn04070   Phosphatidylinositol signaling system sstn04075   Plant hormone signal transduction sstn04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:sstn00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     125854941    04070 Phosphatidylinositol signaling system     125854941    04075 Plant hormone signal transduction     125854941  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     125854941  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sstn01009]     125854941   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sstn04131]     125854941    03036 Chromosome and associated proteins [BR:sstn03036]     125854941   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sstn04147]     125854941 Protein phosphatases and associated proteins [BR:sstn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      125854941 Membrane trafficking [BR:sstn04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     125854941 Chromosome and associated proteins [BR:sstn03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      125854941 Exosome [BR:sstn04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    125854941 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen EF_EFCAB10_C Dockerin_1 SurA_N_3 DUF5580_M MotA_activ SurA_N_2 PA_Ig-like RNA_pol_Rpb4 Motif Other DBs NCBI-GeneID:  125854941 NCBI-ProteinID:  XP_049390508 LinkDB All DBs Position 2:complement(39001130..39001683) Genome browser AA seq 113 aa AA seqDB search MRLLGQNPTEVELQDMINEVDADGNGTIDFPEFLNLTARKMKDTNFEEELKEAFRVVDKD QNRFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcggttgttgggacaaaatccaactgaggttgagcttcaagacatgatcaatgaagtt gatgctgatggaaatggaaccattgacttccccgagttccttaacttgacggctcggaag atgaaagacactaattttgaggaggagctcaaggaagctttcagagtggttgacaaggat cagaatcgattcatttctgcagctgagctacgccatgtcatgacaaacctaggcgagaag cttacagatgaagaggttgacgagatgattcgtgaagctgacgtggatggtgatggacag atcaactatgacgagttcgtcaaggttatgatggccaagtga

DBGET integrated database retrieval system