Solanum stenotomum: 125861367 Help Entry 125861367         CDS       T08385                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sstn  Solanum stenotomum Pathway sstn03083   Polycomb repressive complex sstn04120   Ubiquitin mediated proteolysis sstn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sstn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125861367    04120 Ubiquitin mediated proteolysis     125861367   09126 Chromosome    03083 Polycomb repressive complex     125861367  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sstn04131]     125861367    04121 Ubiquitin system [BR:sstn04121]     125861367    03036 Chromosome and associated proteins [BR:sstn03036]     125861367 Membrane trafficking [BR:sstn04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     125861367 Ubiquitin system [BR:sstn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      125861367    Cul7 complex      125861367 Chromosome and associated proteins [BR:sstn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      125861367   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      125861367 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ DrrA_P4M Nab2 Motif Other DBs NCBI-GeneID:  125861367 NCBI-ProteinID:  XP_049397242 LinkDB All DBs Position 4:23632467..23632841 Genome browser AA seq 124 aa AA seqDB search MSSEKLMTLKTSDGEEFKLDEAIAMRSKVIKNIVQDMDCTSNAIPLFNVDGKTMTTVVKY WKKHLEECVTQDQLKNFGQNFLKMSHSELLGVVLAARYLDDKHLKKVIIQEFVDRITQRI LEEI NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtcttcagaaaaactcatgactcttaagactagcgatggtgaggaattcaaactcgat gaggctatagctatgaggtcaaaagtcatcaagaacatagtacaagacatggattgtact tctaatgccatccctttgtttaatgttgatggaaaaacaatgacaacagtggttaaatat tggaagaagcatttggaggaatgtgttacgcaagatcaattaaagaattttggtcagaat ttcttgaagatgagccactcagaattattgggtgttgtcttggctgctagatatcttgat gataagcatttgaagaaggtaataatccaagaatttgttgatagaatcacacagagaata ctagaggaaatatga

DBGET integrated database retrieval system