Solanum stenotomum: 125871388 Help Entry 125871388         CDS       T08385                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism sstn  Solanum stenotomum Pathway sstn03083   Polycomb repressive complex sstn04120   Ubiquitin mediated proteolysis sstn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sstn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125871388    04120 Ubiquitin mediated proteolysis     125871388   09126 Chromosome    03083 Polycomb repressive complex     125871388  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sstn04131]     125871388    04121 Ubiquitin system [BR:sstn04121]     125871388    03036 Chromosome and associated proteins [BR:sstn03036]     125871388 Membrane trafficking [BR:sstn04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     125871388 Ubiquitin system [BR:sstn04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      125871388    Cul7 complex      125871388 Chromosome and associated proteins [BR:sstn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      125871388   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      125871388 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  125871388 NCBI-ProteinID:  XP_049407927 LinkDB All DBs Position 7:complement(9048598..9049023) Genome browser AA seq 141 aa AA seqDB search MSSSTKFLTLKTCDDKKFLLDEAIAVRSQTIKNMVEDDCVSNVIPLPNIDSKTMTKVIEY WKKHSEEGVSKDMLMDFDKAFVKVHHSILHALILAANFLNDKEILDMMCQEVADRIKGKT PEEIRKEFDIKNDSRGRRGDP NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttcaacaaagttcttaactttaaagacttgcgatgataagaaatttttattg gacgaggcgatagccgtaaggtcacaaactatcaagaatatggttgaagacgattgtgtt tcaaacgtcattcctctgcctaatatcgatagcaaaacaatgaccaaagtgatcgaatac tggaagaaacattcggaggaaggcgtctccaaagacatgctgatggactttgacaaggct tttgtgaaggtgcaccactcgattttgcatgctcttatcttagctgctaattttcttaac gataaggagatattggatatgatgtgtcaagaagttgccgataggattaaagggaaaaca ccagaagaaatacgtaaagaatttgatatcaagaatgattccagaggaagaagaggagat ccgtag

DBGET integrated database retrieval system