Solanum stenotomum: 125874361 Help Entry 125874361         CDS       T08385                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sstn  Solanum stenotomum Pathway sstn04145   Phagosome sstn04148   Efferocytosis sstn04517   IgSF CAM signaling sstn04518   Integrin signaling sstn04620   Toll-like receptor signaling pathway sstn05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sstn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     125874361    04518 Integrin signaling     125874361  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     125874361    04148 Efferocytosis     125874361  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125874361  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     125874361  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sstn04131]     125874361   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sstn04147]     125874361    04031 GTP-binding proteins [BR:sstn04031]     125874361 Membrane trafficking [BR:sstn04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     125874361  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     125874361   Macropinocytosis    Ras GTPases     125874361  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     125874361 Exosome [BR:sstn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125874361   Exosomal proteins of other body fluids (saliva and urine)    125874361   Exosomal proteins of colorectal cancer cells    125874361   Exosomal proteins of bladder cancer cells    125874361 GTP-binding proteins [BR:sstn04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     125874361 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  125874361 NCBI-ProteinID:  XP_049411199 LinkDB All DBs Position 1:complement(886614..891991) Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLREDKQFFVDHPGAVPLSTAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAAIKVVLQP PKQKKKKKRKGQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggtttataaagtgtgttactgtgggcgatggagctgtgggtaaaact tgtcttctcatttcgtataccagcaacacttttcccactgattatgtcccaactgtattt gacaattttagtgcaaatgtggtcgtcgatgggagcactgttaatctggggctctgggat actgcaggtcaggaggattacaatagattaagacctttgagctatcgtggggcagatgta tttatactggcattttctctcattagcaaggcgagctatgaaaatgtctccaaaaagtgg attcctgaattgaggcattatgctcctggagttccaattattcttgttggaacaaagcta gatctccgagaggataaacaattctttgtggaccatccaggtgctgttccacttagcaca gctcagggtgaggagctgagaaagtcgattggtgctgctgcttacattgaatgtagtgca aaaacacaacagaacattaaggctgtttttgatgccgccattaaggtggtcctacaacca cccaagcaaaagaagaagaagaagagaaagggtcagaaagcctgctctatcttatga

DBGET integrated database retrieval system